| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Trans-activator protein BZLF1 |
|---|
| Ligand | BDBM62434 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of EBNA-1: fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of the Epstein-Barr virus-encoded protein, ZTA |
|---|
| IC50 | 111248±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of EBNA-1: fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of the Epstein-Barr virus-encoded protein, ZTA PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Trans-activator protein BZLF1 |
|---|
| Name: | Trans-activator protein BZLF1 |
|---|
| Synonyms: | BZLF1 | BZLF1_EBVB9 | PPP5C protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 26856.37 |
|---|
| Organism: | Human herpesvirus 4 |
|---|
| Description: | gi_82503229 |
|---|
| Residue: | 245 |
|---|
| Sequence: | MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQ
LTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPGDNS
TVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRY
KNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHE
DLLNF
|
|
|
|---|
| BDBM62434 |
|---|
| n/a |
|---|
| Name | BDBM62434 |
|---|
| Synonyms: | MLS000325007 | N-(1,3-benzodioxol-5-yl)-2-[(5E)-2,4-diketo-5-[(1-methylindol-3-yl)methylene]thiazolidin-3-yl]acetamide | N-(1,3-benzodioxol-5-yl)-2-[(5E)-5-[(1-methyl-3-indolyl)methylidene]-2,4-dioxo-3-thiazolidinyl]acetamide | N-(1,3-benzodioxol-5-yl)-2-[(5E)-5-[(1-methylindol-3-yl)methylidene]-2,4-bis(oxidanylidene)-1,3-thiazolidin-3-yl]ethanamide | N-(1,3-benzodioxol-5-yl)-2-[(5E)-5-[(1-methylindol-3-yl)methylidene]-2,4-dioxo-1,3-thiazolidin-3-yl]acetamide | N-(1,3-benzodioxol-5-yl)-2-{5-[(1-methyl-1H-indol-3-yl)methylene]-2,4-dioxo-1,3-thiazolidin-3-yl}acetamide | SMR000160985 | cid_1229516 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H17N3O5S |
|---|
| Mol. Mass. | 435.452 |
|---|
| SMILES | Cn1cc(\C=C2\SC(=O)N(CC(=O)Nc3ccc4OCOc4c3)C2=O)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
