Reaction Details |
| Report a problem with these data |
Target | Trans-activator protein BZLF1 |
---|
Ligand | BDBM62492 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Counterscreen for inhibitors of EBNA-1: fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of the Epstein-Barr virus-encoded protein, ZTA |
---|
IC50 | 111248±n/a nM |
---|
Citation | PubChem, PC Counterscreen for inhibitors of EBNA-1: fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of the Epstein-Barr virus-encoded protein, ZTA PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Trans-activator protein BZLF1 |
---|
Name: | Trans-activator protein BZLF1 |
Synonyms: | BZLF1 | BZLF1_EBVB9 | PPP5C protein |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 26856.37 |
Organism: | Human herpesvirus 4 |
Description: | gi_82503229 |
Residue: | 245 |
Sequence: | MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQ
LTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPGDNS
TVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRY
KNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHE
DLLNF
|
|
|
BDBM62492 |
---|
n/a |
---|
Name | BDBM62492 |
Synonyms: | 2-[(5Z)-2,4-bis(oxidanylidene)-5-[(2,4,6-trimethoxyphenyl)methylidene]-1,3-thiazolidin-3-yl]-N-(2-fluorophenyl)ethanamide | 2-[(5Z)-2,4-diketo-5-(2,4,6-trimethoxybenzylidene)thiazolidin-3-yl]-N-(2-fluorophenyl)acetamide | 2-[(5Z)-2,4-dioxo-5-[(2,4,6-trimethoxyphenyl)methylidene]-1,3-thiazolidin-3-yl]-N-(2-fluorophenyl)acetamide | 2-[(5Z)-2,4-dioxo-5-[(2,4,6-trimethoxyphenyl)methylidene]-3-thiazolidinyl]-N-(2-fluorophenyl)acetamide | 2-[2,4-dioxo-5-(2,4,6-trimethoxybenzylidene)-1,3-thiazolidin-3-yl]-N-(2-fluorophenyl)acetamide | MLS001180205 | SMR000477449 | cid_1231499 |
Type | Small organic molecule |
Emp. Form. | C21H19FN2O6S |
Mol. Mass. | 446.449 |
SMILES | COc1cc(OC)c(\C=C2/SC(=O)N(CC(=O)Nc3ccccc3F)C2=O)c(OC)c1 |
Structure |
|