| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM65817 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | SAR Analysis of Agonists of the DOR Receptor using an Image-Based Assay - Set 2 |
|---|
| EC50 | >32000±n/a nM |
|---|
| Citation |  PubChem, PC SAR Analysis of Agonists of the DOR Receptor using an Image-Based Assay - Set 2 PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM65817 |
|---|
| n/a |
|---|
| Name | BDBM65817 |
|---|
| Synonyms: | 2-[5-[(3,4-dichlorobenzyl)thio]-4-(2-furfuryl)-1,2,4-triazol-3-yl]pyridine | 2-[5-[(3,4-dichlorophenyl)methylsulfanyl]-4-(furan-2-ylmethyl)-1,2,4-triazol-3-yl]pyridine | 2-[5-[(3,4-dichlorophenyl)methylthio]-4-(2-furanylmethyl)-1,2,4-triazol-3-yl]pyridine | KSC-5-240 | KUC103893N | ML138 | cid_44601470 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H14Cl2N4OS |
|---|
| Mol. Mass. | 417.312 |
|---|
| SMILES | Clc1ccc(CSc2nnc(-c3ccccn3)n2Cc2ccco2)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
