| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 11 |
|---|
| Ligand | BDBM61020 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Luminescence Cell-Based Dose Retest to Identify Inhibitors of A1 Apoptosis |
|---|
| EC50 | 1896±n/a nM |
|---|
| Citation |  PubChem, PC Luminescence Cell-Based Dose Retest to Identify Inhibitors of A1 Apoptosis PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-like protein 11 |
|---|
| Name: | Bcl-2-like protein 11 |
|---|
| Synonyms: | B2L11_HUMAN | BCL2-like 11 isoform 1 | BCL2L11 | BIM |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22175.26 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | EBI_101325 |
|---|
| Residue: | 198 |
|---|
| Sequence: | MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
MVILRLLRYIVRLVWRMH
|
|
|
|---|
| BDBM61020 |
|---|
| n/a |
|---|
| Name | BDBM61020 |
|---|
| Synonyms: | (Z)-2-(4-acetyl-5-anilino-thiophene-2-carbonyl)-3-(4-nitrophenyl)acrylic acid ethyl ester | (Z)-2-[(4-acetyl-5-anilino-2-thiophenyl)-oxomethyl]-3-(4-nitrophenyl)-2-propenoic acid ethyl ester | MLS000533195 | SMR000140633 | cid_5725106 | ethyl (Z)-2-(4-acetyl-5-anilinothiophene-2-carbonyl)-3-(4-nitrophenyl)prop-2-enoate | ethyl (Z)-2-(4-ethanoyl-5-phenylazanyl-thiophen-2-yl)carbonyl-3-(4-nitrophenyl)prop-2-enoate | ethyl 2-[(4-acetyl-5-anilino-2-thienyl)carbonyl]-3-(4-nitrophenyl)acrylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H20N2O6S |
|---|
| Mol. Mass. | 464.49 |
|---|
| SMILES | CCOC(=O)C(=Cc1ccc(cc1)[N+]([O-])=O)C(=O)c1cc(C(C)=O)c(Nc2ccccc2)s1 |w:6.6| |
|---|
| Structure | 
|
|---|
Search and Browse
