| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 11 |
|---|
| Ligand | BDBM66418 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Luminescence Cell-Based Dose Retest to Identify Inhibitors of A1 Apoptosis |
|---|
| EC50 | 4647±n/a nM |
|---|
| Citation |  PubChem, PC Luminescence Cell-Based Dose Retest to Identify Inhibitors of A1 Apoptosis PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-like protein 11 |
|---|
| Name: | Bcl-2-like protein 11 |
|---|
| Synonyms: | B2L11_HUMAN | BCL2-like 11 isoform 1 | BCL2L11 | BIM |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22175.26 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | EBI_101325 |
|---|
| Residue: | 198 |
|---|
| Sequence: | MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
MVILRLLRYIVRLVWRMH
|
|
|
|---|
| BDBM66418 |
|---|
| n/a |
|---|
| Name | BDBM66418 |
|---|
| Synonyms: | (E)-2-cyano-N-(3,5-dimethylphenyl)-3-[1-[2-(2-furanylmethylamino)-2-oxoethyl]-3-indolyl]-2-propenamide | (E)-2-cyano-N-(3,5-dimethylphenyl)-3-[1-[2-(2-furfurylamino)-2-keto-ethyl]indol-3-yl]acrylamide | (E)-2-cyano-N-(3,5-dimethylphenyl)-3-[1-[2-(furan-2-ylmethylamino)-2-oxidanylidene-ethyl]indol-3-yl]prop-2-enamide | (E)-2-cyano-N-(3,5-dimethylphenyl)-3-[1-[2-(furan-2-ylmethylamino)-2-oxoethyl]indol-3-yl]prop-2-enamide | 2-Cyano-N-(3,5-dimethyl-phenyl)-3-(1-{[(furan-2-ylmethyl)-carbamoyl]-methyl}-1H-indol-3-yl)-acrylamide | MLS000569212 | SMR000177747 | cid_5446513 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H24N4O3 |
|---|
| Mol. Mass. | 452.5045 |
|---|
| SMILES | Cc1cc(C)cc(NC(=O)C(=C\c2cn(CC(=O)NCc3ccco3)c3ccccc23)\C#N)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
