| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 11 |
|---|
| Ligand | BDBM61114 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Luminescence Cell-Based Dose Retest to Identify Inhibitors of A1 Apoptosis |
|---|
| EC50 | 5770±n/a nM |
|---|
| Citation |  PubChem, PC Luminescence Cell-Based Dose Retest to Identify Inhibitors of A1 Apoptosis PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-like protein 11 |
|---|
| Name: | Bcl-2-like protein 11 |
|---|
| Synonyms: | B2L11_HUMAN | BCL2-like 11 isoform 1 | BCL2L11 | BIM |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22175.26 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | EBI_101325 |
|---|
| Residue: | 198 |
|---|
| Sequence: | MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
MVILRLLRYIVRLVWRMH
|
|
|
|---|
| BDBM61114 |
|---|
| n/a |
|---|
| Name | BDBM61114 |
|---|
| Synonyms: | 2,6-di-tert-butyl-4-(3,4-dimethoxybenzylidene)-2,5-cyclohexadien-1-one | 2,6-ditert-butyl-4-[(3,4-dimethoxyphenyl)methylidene]-1-cyclohexa-2,5-dienone | 2,6-ditert-butyl-4-[(3,4-dimethoxyphenyl)methylidene]cyclohexa-2,5-dien-1-one | 2,6-ditert-butyl-4-veratrylidene-cyclohexa-2,5-dien-1-one | MLS001163486 | SMR000496761 | cid_2868490 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30O3 |
|---|
| Mol. Mass. | 354.4825 |
|---|
| SMILES | [#6]-[#8]-c1ccc(\[#6]=[#6]-2\[#6]=[#6](-[#6](=O)-[#6](=[#6]-2)C([#6])([#6])[#6])C([#6])([#6])[#6])cc1-[#8]-[#6] |c:8,12| |
|---|
| Structure | 
|
|---|
Search and Browse
