| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Guanine nucleotide-binding protein G(o) subunit alpha |
|---|
| Ligand | BDBM67700 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao with additional round of SAR compounds |
|---|
| EC50 | >30000±0 nM |
|---|
| Citation |  PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao with additional round of SAR compounds PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Guanine nucleotide-binding protein G(o) subunit alpha |
|---|
| Name: | Guanine nucleotide-binding protein G(o) subunit alpha |
|---|
| Synonyms: | GNAO1 | GNAO_HUMAN | Guanine nucleotide-binding protein G(o), alpha subunit 1 | guanine nucleotide-binding protein G(o) subunit alpha isoform a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 40043.59 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_321106 |
|---|
| Residue: | 354 |
|---|
| Sequence: | MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
|
|
|
|---|
| BDBM67700 |
|---|
| n/a |
|---|
| Name | BDBM67700 |
|---|
| Synonyms: | 3-chloranyl-6-nitro-1-benzothiophene-2-carboxamide | 3-chloro-6-nitro-1-benzothiophene-2-carboxamide | 3-chloro-6-nitro-benzothiophene-2-carboxamide | KSC-1-100 | KUC103873N | cid_874677 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H5ClN2O3S |
|---|
| Mol. Mass. | 256.666 |
|---|
| SMILES | NC(=O)c1sc2cc(ccc2c1Cl)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
