| Reaction Details |
|---|
 | Report a problem with these data |
| Target | DNA damage-inducible transcript 3 protein |
|---|
| Ligand | BDBM36923 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  PubChem, PC Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| DNA damage-inducible transcript 3 protein |
|---|
| Name: | DNA damage-inducible transcript 3 protein |
|---|
| Synonyms: | Chop | Chop10 | DDIT3_MOUSE | Ddit3 | Gadd153 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 19175.17 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | gi_160707929 |
|---|
| Residue: | 168 |
|---|
| Sequence: | MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASL
AWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMK
EKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
|
|
|
|---|
| BDBM36923 |
|---|
| n/a |
|---|
| Name | BDBM36923 |
|---|
| Synonyms: | (Z)-3,4-bis(benzenesulfonyl)-2-buten-1-ol | (Z)-3,4-bis(benzenesulfonyl)but-2-en-1-ol | (Z)-3,4-bis(phenylsulfonyl)but-2-en-1-ol | (Z)-3,4-dibesylbut-2-en-1-ol | MLS000080860 | SMR000043655 | cid_5389617 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H16O5S2 |
|---|
| Mol. Mass. | 352.425 |
|---|
| SMILES | OC\C=C(\CS(=O)(=O)c1ccccc1)S(=O)(=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
