Reaction Details |
| Report a problem with these data |
Target | DNA damage-inducible transcript 3 protein |
---|
Ligand | BDBM41384 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress |
---|
IC50 | >10000±n/a nM |
---|
Citation | PubChem, PC Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
DNA damage-inducible transcript 3 protein |
---|
Name: | DNA damage-inducible transcript 3 protein |
Synonyms: | Chop | Chop10 | DDIT3_MOUSE | Ddit3 | Gadd153 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 19175.17 |
Organism: | Mus musculus |
Description: | gi_160707929 |
Residue: | 168 |
Sequence: | MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASL
AWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMK
EKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
|
|
|
BDBM41384 |
---|
n/a |
---|
Name | BDBM41384 |
Synonyms: | MLS000042033 | N-[(1S,2R)-1-[5-(2,5-dimethylbenzyl)sulfonyl-1,3,4-oxadiazol-2-yl]-2-methyl-butyl]carbamic acid tert-butyl ester | N-[(1S,2R)-1-[5-[(2,5-dimethylphenyl)methylsulfonyl]-1,3,4-oxadiazol-2-yl]-2-methylbutyl]carbamic acid tert-butyl ester | SMR000045309 | cid_664366 | tert-butyl N-[(1S,2R)-1-[5-[(2,5-dimethylphenyl)methylsulfonyl]-1,3,4-oxadiazol-2-yl]-2-methyl-butyl]carbamate | tert-butyl N-[(1S,2R)-1-[5-[(2,5-dimethylphenyl)methylsulfonyl]-1,3,4-oxadiazol-2-yl]-2-methylbutyl]carbamate |
Type | Small organic molecule |
Emp. Form. | C21H31N3O5S |
Mol. Mass. | 437.553 |
SMILES | CC[C@@H](C)[C@H](NC(=O)OC(C)(C)C)c1nnc(o1)S(=O)(=O)Cc1cc(C)ccc1C |
Structure |
|