| Reaction Details |
|---|
 | Report a problem with these data |
| Target | S-ribosylhomocysteine lyase |
|---|
| Ligand | BDBM65981 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Luminescence Cell-Free Homogeneous Dose Response to Identify Inhibitors of Lux-S |
|---|
| EC50 | >350000±n/a nM |
|---|
| Citation |  PubChem, PC Luminescence Cell-Free Homogeneous Dose Response to Identify Inhibitors of Lux-S PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| S-ribosylhomocysteine lyase |
|---|
| Name: | S-ribosylhomocysteine lyase |
|---|
| Synonyms: | LuxS |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 15564.06 |
|---|
| Organism: | Vibrio harveyi |
|---|
| Description: | B0LUE4 |
|---|
| Residue: | 140 |
|---|
| Sequence: | MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY
AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI
PELNEYQCGTAAMHSLDEAK
|
|
|
|---|
| BDBM65981 |
|---|
| n/a |
|---|
| Name | BDBM65981 |
|---|
| Synonyms: | MLS001176288 | N-(4-fluorophenyl)sulfonyl-N-methyl-4-propyl-benzenesulfonamide | N-(4-fluorophenyl)sulfonyl-N-methyl-4-propylbenzenesulfonamide | SMR000591598 | cid_8933071 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H18FNO4S2 |
|---|
| Mol. Mass. | 371.447 |
|---|
| SMILES | CCCc1ccc(cc1)S(=O)(=O)N(C)S(=O)(=O)c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
