| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein Rev |
|---|
| Ligand | BDBM51080 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of gld-1: Fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of the HIV Rev protein-RRE RNA interaction |
|---|
| IC50 | >75386±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of gld-1: Fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of the HIV Rev protein-RRE RNA interaction PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Protein Rev |
|---|
| Name: | Protein Rev |
|---|
| Synonyms: | Human immunodeficiency virus type 1 REV | REV_HV1H2 | rev |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13078.11 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_79479 |
|---|
| Residue: | 116 |
|---|
| Sequence: | MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIL
GTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE
|
|
|
|---|
| BDBM51080 |
|---|
| n/a |
|---|
| Name | BDBM51080 |
|---|
| Synonyms: | 4-[(2Z)-2-(2-oxo-1-naphthalenylidene)hydrazinyl]-1H-imidazole-5-carboxylic acid ethyl ester | 4-[(N'Z)-N'-(2-keto-1-naphthylidene)hydrazino]-1H-imidazole-5-carboxylic acid ethyl ester | MLS000705197 | SMR000231024 | cid_6078945 | ethyl 4-[(2Z)-2-(2-oxidanylidenenaphthalen-1-ylidene)hydrazinyl]-1H-imidazole-5-carboxylate | ethyl 4-[(2Z)-2-(2-oxonaphthalen-1-ylidene)hydrazinyl]-1H-imidazole-5-carboxylate | ethyl 5-[(2-hydroxy-1-naphthyl)diazenyl]-1H-imidazole-4-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H14N4O3 |
|---|
| Mol. Mass. | 310.3074 |
|---|
| SMILES | CCOC(=O)c1[nH]cnc1N=Nc1c(O)ccc2ccccc12 |w:10.10| |
|---|
| Structure | 
|
|---|
Search and Browse
