| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein Rev |
|---|
| Ligand | BDBM52490 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of gld-1: Fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of the HIV Rev protein-RRE RNA interaction |
|---|
| IC50 | >75418±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of gld-1: Fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of the HIV Rev protein-RRE RNA interaction PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Protein Rev |
|---|
| Name: | Protein Rev |
|---|
| Synonyms: | Human immunodeficiency virus type 1 REV | REV_HV1H2 | rev |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13078.11 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_79479 |
|---|
| Residue: | 116 |
|---|
| Sequence: | MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIL
GTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE
|
|
|
|---|
| BDBM52490 |
|---|
| n/a |
|---|
| Name | BDBM52490 |
|---|
| Synonyms: | MLS000574936 | SMR000156318 | cid_284998 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H19NO6 |
|---|
| Mol. Mass. | 381.3787 |
|---|
| SMILES | COc1cc2C(=O)c3nccc4c(OC)c(OC)c(OC)c(-c2cc1OC)c34 |
|---|
| Structure | 
|
|---|
Search and Browse
