| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Eukaryotic translation initiation factor 4H |
|---|
| Ligand | BDBM50995 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | SAR analysis for the identification of translation initiation inhibitors (eIF4H) |
|---|
| IC50 | 5800±n/a nM |
|---|
| Citation |  PubChem, PC SAR analysis for the identification of translation initiation inhibitors (eIF4H) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Eukaryotic translation initiation factor 4H |
|---|
| Name: | Eukaryotic translation initiation factor 4H |
|---|
| Synonyms: | EIF4H | IF4H_HUMAN | KIAA0038 | WBSCR1 | WSCR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 27385.24 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q15056 |
|---|
| Residue: | 248 |
|---|
| Sequence: | MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDA
IFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRK
QDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPM
GSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPRE
EVVQKEQE
|
|
|
|---|
| BDBM50995 |
|---|
| n/a |
|---|
| Name | BDBM50995 |
|---|
| Synonyms: | 2-{4-[(4-Hydroxy-benzoyl)-hydrazonomethyl]-phenoxy}-N-(4-nitro-phenyl)-acetamide | 4-hydroxy-N-[[4-[2-(4-nitroanilino)-2-oxoethoxy]phenyl]methylideneamino]benzamide | 4-hydroxy-N-[[4-[2-keto-2-(4-nitroanilino)ethoxy]benzylidene]amino]benzamide | MLS000548295 | N-[[4-[2-[(4-nitrophenyl)amino]-2-oxidanylidene-ethoxy]phenyl]methylideneamino]-4-oxidanyl-benzamide | SMR000171643 | cid_3115893 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18N4O6 |
|---|
| Mol. Mass. | 434.4015 |
|---|
| SMILES | Oc1ccc(cc1)C(=O)NN=Cc1ccc(OCC(=O)Nc2ccc(cc2)[N+]([O-])=O)cc1 |w:10.10| |
|---|
| Structure | 
|
|---|
Search and Browse
