| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Ligand | BDBM74444 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of HTS hits from an HePTP Fluorescent Assay using OMFP substrate - Set 2 |
|---|
| IC50 | >79400±0 nM |
|---|
| Citation |  PubChem, PC Dose Response confirmation of HTS hits from an HePTP Fluorescent Assay using OMFP substrate - Set 2 PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Synonyms: | He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 40530.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P35236 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
|
|
|
|---|
| BDBM74444 |
|---|
| n/a |
|---|
| Name | BDBM74444 |
|---|
| Synonyms: | 4-Isopropyl-4H-furo[3,2-b]pyrrole-5-carboxylic acid [(benzo[1,3]dioxol-5-ylmethyl)-carbamoyl]-methyl ester | 4-isopropylfuro[3,2-b]pyrrole-5-carboxylic acid [2-keto-2-(piperonylamino)ethyl] ester | 4-propan-2-yl-5-furo[3,2-b]pyrrolecarboxylic acid [2-(1,3-benzodioxol-5-ylmethylamino)-2-oxoethyl] ester | MLS000035170 | SMR000008063 | [2-(1,3-benzodioxol-5-ylmethylamino)-2-oxidanylidene-ethyl] 4-propan-2-ylfuro[3,2-b]pyrrole-5-carboxylate | [2-(1,3-benzodioxol-5-ylmethylamino)-2-oxoethyl] 4-propan-2-ylfuro[3,2-b]pyrrole-5-carboxylate | cid_648085 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H20N2O6 |
|---|
| Mol. Mass. | 384.3826 |
|---|
| SMILES | CC(C)n1c(cc2occc12)C(=O)OCC(=O)NCc1ccc2OCOc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
