new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHematopoietic protein-tyrosine phosphatase (HEPTP)
LigandBDBM32102
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of HTS hits from an HePTP Fluorescent Assay using OMFP substrate - Set 2
IC50<1240±0 nM
Citation PubChem PC Dose Response confirmation of HTS hits from an HePTP Fluorescent Assay using OMFP substrate - Set 2 PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hematopoietic protein-tyrosine phosphatase (HEPTP)
Name:Hematopoietic protein-tyrosine phosphatase (HEPTP)
Synonyms:He-PTP | Hematopoietic protein-tyrosine phosphatase | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP)
Type:Protein
Mol. Mass.:40530.79
Organism:Homo sapiens (Human)
Description:P35236
Residue:360
Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32102
n/a
NameBDBM32102
Synonyms:1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7(1H,6H)-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-quinone | MLS000087831 | SMR000024051 | US9284299, PKF118-310 | US9738628, Compound PKF118-310 | cid_66541
TypeSmall organic molecule
Emp. Form.C7H7N5O2
Mol. Mass.193.1628
SMILESCn1ncnc2c1nc(=O)n(C)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: