Reaction Details |
| Report a problem with these data |
Target | Tyrosine-protein phosphatase non-receptor type 7 |
---|
Ligand | BDBM33642 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of HTS hits from an HePTP Fluorescent Assay using OMFP substrate - Set 2 |
---|
IC50 | >79400±0 nM |
---|
Citation | PubChem, PC Dose Response confirmation of HTS hits from an HePTP Fluorescent Assay using OMFP substrate - Set 2 PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Tyrosine-protein phosphatase non-receptor type 7 |
---|
Name: | Tyrosine-protein phosphatase non-receptor type 7 |
Synonyms: | He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP) |
Type: | Protein |
Mol. Mass.: | 40530.79 |
Organism: | Homo sapiens (Human) |
Description: | P35236 |
Residue: | 360 |
Sequence: | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
|
|
|
BDBM33642 |
---|
n/a |
---|
Name | BDBM33642 |
Synonyms: | MLS000527911 | SMR000120485 | [3-(4-Chloro-phenyl)-5-methylsulfanyl-[1,2,4]triazol-1-yl]-furan-2-yl-methanone | [3-(4-chlorophenyl)-5-(methylthio)-1,2,4-triazol-1-yl]-(2-furanyl)methanone | [3-(4-chlorophenyl)-5-(methylthio)-1,2,4-triazol-1-yl]-(2-furyl)methanone | [3-(4-chlorophenyl)-5-methylsulfanyl-1,2,4-triazol-1-yl]-(furan-2-yl)methanone | cid_828535 |
Type | Small organic molecule |
Emp. Form. | C14H10ClN3O2S |
Mol. Mass. | 319.766 |
SMILES | CSc1nc(nn1C(=O)c1ccco1)-c1ccc(Cl)cc1 |
Structure |
|