Reaction Details |
| Report a problem with these data |
Target | Tyrosine-protein phosphatase non-receptor type 7 |
---|
Ligand | BDBM74525 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of HTS hits from an HePTP Fluorescent Assay using OMFP substrate - Set 2 |
---|
IC50 | 7331±307 nM |
---|
Citation | PubChem, PC Dose Response confirmation of HTS hits from an HePTP Fluorescent Assay using OMFP substrate - Set 2 PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Tyrosine-protein phosphatase non-receptor type 7 |
---|
Name: | Tyrosine-protein phosphatase non-receptor type 7 |
Synonyms: | He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP) |
Type: | Protein |
Mol. Mass.: | 40530.79 |
Organism: | Homo sapiens (Human) |
Description: | P35236 |
Residue: | 360 |
Sequence: | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
|
|
|
BDBM74525 |
---|
n/a |
---|
Name | BDBM74525 |
Synonyms: | 4-(3-{[[(2E)-2-(1,3-benzodioxol-5-ylmethylene)hydrazino](imino)methyl]thio}-2,5-dioxopyrrolidin-1-yl)benzoic acid | 4-[2,5-diketo-3-[[N'-(piperonylideneamino)amidino]thio]pyrrolidino]benzoic acid | 4-[3-[N'-(1,3-benzodioxol-5-ylmethylideneamino)carbamimidoyl]sulfanyl-2,5-bis(oxidanylidene)pyrrolidin-1-yl]benzoic acid | 4-[3-[N'-(1,3-benzodioxol-5-ylmethylideneamino)carbamimidoyl]sulfanyl-2,5-dioxopyrrolidin-1-yl]benzoic acid | 4-[3-[[amino-(1,3-benzodioxol-5-ylmethylidenehydrazinylidene)methyl]thio]-2,5-dioxo-1-pyrrolidinyl]benzoic acid | MLS000689648 | SMR000312892 | cid_3848047 |
Type | Small organic molecule |
Emp. Form. | C20H16N4O6S |
Mol. Mass. | 440.429 |
SMILES | OC(=O)c1ccc(cc1)-n1c(O)cc(SC(=N)NN=Cc2ccc3OCOc3c2)c1O |w:18.18| |
Structure |
|