| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 4 |
|---|
| Ligand | BDBM75602 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Late-stage fluorescence dose-response cell-based assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Synthesized compounds |
|---|
| EC50 | 46.3±n/a nM |
|---|
| Citation |  PubChem, PC Late-stage fluorescence dose-response cell-based assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Synthesized compounds PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 4 |
|---|
| Name: | Sphingosine 1-phosphate receptor 4 |
|---|
| Synonyms: | EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | S1PR4 | S1PR4_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41647.39 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 384 |
|---|
| Sequence: | MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
|
|
|
|---|
| BDBM75602 |
|---|
| n/a |
|---|
| Name | BDBM75602 |
|---|
| Synonyms: | 2,6-dibromo-3-[2-(2,4-dichlorophenoxy)ethoxy]pyridine | 3-[2-[2,4-bis(chloranyl)phenoxy]ethoxy]-2,6-bis(bromanyl)pyridine | CYM50179 | ML178 | SR-02000000304 | SR-02000000304-1 | cid_44620892 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H9Br2Cl2NO2 |
|---|
| Mol. Mass. | 441.93 |
|---|
| SMILES | Clc1ccc(OCCOc2ccc(Br)nc2Br)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
