| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanin-concentrating hormone receptor 1 |
|---|
| Ligand | BDBM75872 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Late-stage fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7) |
|---|
| IC50 | 13700±n/a nM |
|---|
| Citation |  PubChem, PC Late-stage fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7): cell-based dose response assay to identify antagonists of the melanin-concentrating hormone receptor 1 (MCHR1) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Melanin-concentrating hormone receptor 1 |
|---|
| Name: | Melanin-concentrating hormone receptor 1 |
|---|
| Synonyms: | G-protein coupled receptor 24 | GPR24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCHR | MCHR-1 | MCHR1 | MCHR1_HUMAN | Melanin Concentrating Hormone 1 | Melanin-Concentrating Hormone Receptor 1 (MCH1R) | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1 (MCH-1) | Melanin-concentrating hormone receptor 1 (MCH1) | Melanin-concentrating hormone receptor 1 (MCHR-1) | Melanin-concentrating hormone receptor 1 (MCHR1) | SLC-1 | SLC1 | Somatostatin receptor-like protein |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 45976.27 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Membranes from CHO-K1 cells stably expressing human MCH1R were used in assays. |
|---|
| Residue: | 422 |
|---|
| Sequence: | MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
|
|
|
|---|
| BDBM75872 |
|---|
| n/a |
|---|
| Name | BDBM75872 |
|---|
| Synonyms: | 5-chloranyl-2-(4-methylphenyl)-4-phenoxy-pyridazin-3-one | 5-chloro-2-(4-methylphenyl)-4-phenoxy-3-pyridazinone | 5-chloro-2-(4-methylphenyl)-4-phenoxypyridazin-3-one | 5-chloro-4-phenoxy-2-(p-tolyl)pyridazin-3-one | SR-02000000337 | SR-02000000337-1 | cid_45382325 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H13ClN2O2 |
|---|
| Mol. Mass. | 312.75 |
|---|
| SMILES | Cc1ccc(cc1)-n1ncc(Cl)c(Oc2ccccc2)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
