Reaction Details |
| Report a problem with these data |
Target | Caspase-3 |
---|
Ligand | BDBM76650 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Caspase-3 Selectivity assay |
---|
IC50 | 31300±n/a nM |
---|
Citation | PubChem, PC Dose Response confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Caspase-3 Selectivity assay PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Caspase-3 |
---|
Name: | Caspase-3 |
Synonyms: | Apopain | CASP-3 | CASP3 | CASP3_HUMAN | CPP-32 | CPP32 | Caspase 3 | Caspase-3 subunit p12 | Caspase-3 subunit p17 | Cysteine protease CPP32 | SCA-1 | SREBP cleavage activity 1 | Yama protein | caspase-3 preproprotein |
Type: | Hydrolase; heterotetramer of two heterodimers |
Mol. Mass.: | 31607.55 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 277 |
Sequence: | MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
|
|
|
BDBM76650 |
---|
n/a |
---|
Name | BDBM76650 |
Synonyms: | 2-bromobenzoic acid [1-(4-methylphenyl)ethylideneamino] ester | 2-bromobenzoic acid [1-(p-tolyl)ethylideneamino] ester | MLS001209490 | SMR000513341 | The compound has not trivial name. | [1-(4-methylphenyl)ethylideneamino] 2-bromanylbenzoate | [1-(4-methylphenyl)ethylideneamino] 2-bromobenzoate | cid_708195 |
Type | Small organic molecule |
Emp. Form. | C16H14BrNO2 |
Mol. Mass. | 332.192 |
SMILES | CC(=NOC(=O)c1ccccc1Br)c1ccc(C)cc1 |
Structure |
|