| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sentrin-specific protease 8 |
|---|
| Ligand | BDBM76433 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of uHTS for inhibitors of Sentrin-specific protease 8 (SENP8) using a Luminescent assay |
|---|
| IC50 | 1560±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response confirmation of uHTS for inhibitors of Sentrin-specific protease 8 (SENP8) using a Luminescent assay PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Sentrin-specific protease 8 |
|---|
| Name: | Sentrin-specific protease 8 |
|---|
| Synonyms: | DEN1 | NEDP1 | PRSC2 | SENP8 | SENP8_HUMAN | SUMO/sentrin specific peptidase family member 8 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 24104.52 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_262118306 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQ
FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDS
HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR
QQTESLLQLLTPAYITKKRGEWKDLITTLAKK
|
|
|
|---|
| BDBM76433 |
|---|
| n/a |
|---|
| Name | BDBM76433 |
|---|
| Synonyms: | 2-[3-(6-Methyl-1H-benzoimidazol-2-yl)-pyridin-2-ylsulfanyl]-1-(2-methyl-2,3-dihydro-indol-1-yl)-ethanone | 2-[3-(6-methyl-1H-benzimidazol-2-yl)pyridin-2-yl]sulfanyl-1-(2-methyl-2,3-dihydroindol-1-yl)ethanone | 2-[[3-(6-methyl-1H-benzimidazol-2-yl)-2-pyridinyl]thio]-1-(2-methyl-2,3-dihydroindol-1-yl)ethanone | 2-[[3-(6-methyl-1H-benzimidazol-2-yl)-2-pyridyl]thio]-1-(2-methylindolin-1-yl)ethanone | MLS000557795 | SMR000173693 | cid_3231085 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H22N4OS |
|---|
| Mol. Mass. | 414.523 |
|---|
| SMILES | CC1Cc2ccccc2N1C(=O)CSc1ncccc1-c1nc2ccc(C)cc2[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
