| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sentrin-specific protease 8 |
|---|
| Ligand | BDBM35523 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Luminescent Interference Counterscreen assay |
|---|
| IC50 | >5000±0 nM |
|---|
| Citation |  PubChem, PC Dose Response confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Luminescent Interference Counterscreen assay PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Sentrin-specific protease 8 |
|---|
| Name: | Sentrin-specific protease 8 |
|---|
| Synonyms: | DEN1 | NEDP1 | PRSC2 | SENP8 | SENP8_HUMAN | SUMO/sentrin specific peptidase family member 8 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 24104.52 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_262118306 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQ
FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDS
HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR
QQTESLLQLLTPAYITKKRGEWKDLITTLAKK
|
|
|
|---|
| BDBM35523 |
|---|
| n/a |
|---|
| Name | BDBM35523 |
|---|
| Synonyms: | 1,2,9,10-tetramethoxy-6-methyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline | Bromcholitin | Glaucine | MLS000111916 | SMR000107835 | cid_10145 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25NO4 |
|---|
| Mol. Mass. | 355.4275 |
|---|
| SMILES | COc1cc2CC3N(C)CCc4cc(OC)c(OC)c(-c2cc1OC)c34 |
|---|
| Structure | 
|
|---|
Search and Browse
