Reaction Details |
| Report a problem with these data |
Target | G-protein coupled receptor 35 |
---|
Ligand | BDBM61632 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | SAR Analysis for the identification of Selective Antagonists of ERK1/2 Activity in GPR35-Overexpressing U2OS Cells - Set 2 |
---|
IC50 | 1390±92.43 nM |
---|
Citation | PubChem, PC SAR Analysis for the identification of Selective Antagonists of ERK1/2 Activity in GPR35-Overexpressing U2OS Cells - Set 2 PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
G-protein coupled receptor 35 |
---|
Name: | G-protein coupled receptor 35 |
Synonyms: | G protein-coupled receptor 35 | GPR35 | GPR35_HUMAN |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 34085.57 |
Organism: | Homo sapiens (Human) |
Description: | gi_33695097 |
Residue: | 309 |
Sequence: | MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMT
NLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRH
PLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGF
YLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVR
LAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKS
QDSLCVTLA
|
|
|
BDBM61632 |
---|
n/a |
---|
Name | BDBM61632 |
Synonyms: | 5-[(E)-(tert-butylthiocarbamoylhydrazono)methyl]-1-(2,4-difluorophenyl)pyrazole-4-carboxylic acid methyl ester | 5-[(tert-butylthiocarbamoylhydrazono)methyl]-1-(2,4-difluorophenyl)pyrazole-4-carboxylic acid methyl ester | 5-[[[(tert-butylamino)-sulfanylidenemethyl]hydrazinylidene]methyl]-1-(2,4-difluorophenyl)-4-pyrazolecarboxylic acid methyl ester | MLS000834953 | SMR000461569 | cid_2745687 | methyl 1-[2,4-bis(fluoranyl)phenyl]-5-[(tert-butylcarbamothioylhydrazinylidene)methyl]pyrazole-4-carboxylate | methyl 5-[(tert-butylcarbamothioylhydrazinylidene)methyl]-1-(2,4-difluorophenyl)pyrazole-4-carboxylate | methyl 5-{2-[(tert-butylamino)carbothioyl]carbohydrazonoyl}-1-(2,4-difluorophenyl)-1H-pyrazole-4-carboxylate |
Type | Small organic molecule |
Emp. Form. | C17H19F2N5O2S |
Mol. Mass. | 395.427 |
SMILES | COC(=O)c1cnn(c1C=NNC(=S)NC(C)(C)C)-c1ccc(F)cc1F |w:10.11| |
Structure |
|