| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitochondrial import inner membrane translocase subunit TIM10 |
|---|
| Ligand | BDBM68093 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of uHTS small molecule inhibitors of tim10-1 yeast via a luminescent assay |
|---|
| IC50 | 47300±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response confirmation of uHTS small molecule inhibitors of tim10-1 yeast via a luminescent assay PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Mitochondrial import inner membrane translocase subunit TIM10 |
|---|
| Name: | Mitochondrial import inner membrane translocase subunit TIM10 |
|---|
| Synonyms: | MRS11 | TIM10 | TIM10_YEAST | TPA: Essential protein of the mitochondrial intermembrane space | TPA: Essential protein of the mitochondrial intermembrane space, forms a complex with Tim9p (TIM10 complex) that delivers hydrophobic proteins to the TIM22 complex for insertion into the inner ... |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 10303.50 |
|---|
| Organism: | Saccharomyces cerevisiae S288c |
|---|
| Description: | gi_285809906 |
|---|
| Residue: | 93 |
|---|
| Sequence: | MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESS
CLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF
|
|
|
|---|
| BDBM68093 |
|---|
| n/a |
|---|
| Name | BDBM68093 |
|---|
| Synonyms: | MLS000680307 | N-(3-chloranyl-4-methyl-phenyl)-2-[2-[2-(3,3-dimethylbutan-2-ylidene)hydrazinyl]-4-oxidanylidene-1,3-thiazol-5-yl]ethanamide | N-(3-chloro-4-methyl-phenyl)-2-[4-keto-2-[N'-(1,2,2-trimethylpropylidene)hydrazino]-2-thiazolin-5-yl]acetamide | N-(3-chloro-4-methylphenyl)-2-[2-[2-(3,3-dimethylbutan-2-ylidene)hydrazinyl]-4-oxo-1,3-thiazol-5-yl]acetamide | N-(3-chloro-4-methylphenyl)-2-[2-[2-(3,3-dimethylbutan-2-ylidene)hydrazinyl]-4-oxo-5-thiazolyl]acetamide | N-(3-chloro-4-methylphenyl)-2-{4-hydroxy-2-[(1,2,2-trimethylpropylidene)hydrazono]-2,5-dihydro-1,3-thiazol-5-yl}acetamide | SMR000268447 | cid_4353993 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H23ClN4O2S |
|---|
| Mol. Mass. | 394.919 |
|---|
| SMILES | CC(N=Nc1nc(O)c(CC(=O)Nc2ccc(C)c(Cl)c2)s1)C(C)(C)C |w:2.1| |
|---|
| Structure | 
|
|---|
Search and Browse
