Reaction Details |
| Report a problem with these data |
Target | Ubiquitin-conjugating enzyme E2 N |
---|
Ligand | BDBM51939 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay |
---|
IC50 | 8327±804 nM |
---|
Citation | PubChem, PC Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay PubChem Bioassay(2011)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Ubiquitin-conjugating enzyme E2 N |
---|
Name: | Ubiquitin-conjugating enzyme E2 N |
Synonyms: | BLU | UBE2N | UBE2N_HUMAN | ubiquitin-conjugating enzyme E2 N |
Type: | PROTEIN |
Mol. Mass.: | 17137.61 |
Organism: | Homo sapiens (Human) |
Description: | EBI_101440 |
Residue: | 152 |
Sequence: | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI
|
|
|
BDBM51939 |
---|
n/a |
---|
Name | BDBM51939 |
Synonyms: | 4-(3,4-dihydro-1H-isoquinolin-2-ylsulfonyl)-N-[3-(dimethylamino)propyl]-N-(4-ethoxy-1,3-benzothiazol-2-yl)benzamide;hydrochloride | MLS001239352 | SMR000807819 | cid_24892053 |
Type | Small organic molecule |
Emp. Form. | C30H34N4O4S2 |
Mol. Mass. | 578.745 |
SMILES | CCOc1cccc2sc(nc12)N(CCCN(C)C)C(=O)c1ccc(cc1)S(=O)(=O)N1CCc2ccccc2C1 |
Structure |
|