| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ubiquitin-conjugating enzyme E2 N |
|---|
| Ligand | BDBM43864 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay reconfirm |
|---|
| IC50 | 1700±28 nM |
|---|
| Citation |  PubChem, PC Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay reconfirm PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Ubiquitin-conjugating enzyme E2 N |
|---|
| Name: | Ubiquitin-conjugating enzyme E2 N |
|---|
| Synonyms: | BLU | UBE2N | UBE2N_HUMAN | ubiquitin-conjugating enzyme E2 N |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17137.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | EBI_101440 |
|---|
| Residue: | 152 |
|---|
| Sequence: | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI
|
|
|
|---|
| BDBM43864 |
|---|
| n/a |
|---|
| Name | BDBM43864 |
|---|
| Synonyms: | 2-chloranyl-N1,N4-bis[4-(4,5-dihydro-1H-imidazol-2-yl)phenyl]benzene-1,4-dicarboxamide | 2-chloro-1-N,4-N-bis[4-(4,5-dihydro-1H-imidazol-2-yl)phenyl]benzene-1,4-dicarboxamide | 2-chloro-N,N''''-bis[4-(2-imidazolin-2-yl)phenyl]terephthalamide | 2-chloro-N,N''-bis[4-(2-imidazolin-2-yl)phenyl]terephthalamide | 2-chloro-N,N'-bis[4-(2-imidazolin-2-yl)phenyl]terephthalamide | 2-chloro-N1,N4-bis[4-(4,5-dihydro-1H-imidazol-2-yl)phenyl]benzene-1,4-dicarboxamide | Glycopeptide, 3b | HR 2198 | MLS000737368 | SMR000528281 | cid_65558 |
|---|
| Type | Peptide |
|---|
| Emp. Form. | C26H23ClN6O2 |
|---|
| Mol. Mass. | 486.953 |
|---|
| SMILES | Clc1cc(ccc1C(=O)Nc1ccc(cc1)C1=NCCN1)C(=O)Nc1ccc(cc1)C1=NCCN1 |t:18,34| |
|---|
| Structure | 
|
|---|
Search and Browse
