| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Caspase-7 |
|---|
| Ligand | BDBM79429 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response assay for dual activators of procaspase-3 and procaspase-7: Absorbance-based biochemical high throughput screening assay to identify activators of procaspase-7 |
|---|
| EC50 | >85318±n/a nM |
|---|
| Citation |  PubChem, PC Dose response assay for dual activators of procaspase-3 and procaspase-7: Absorbance-based biochemical high throughput screening assay to identify activators of procaspase-7 PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Caspase-7 |
|---|
| Name: | Caspase-7 |
|---|
| Synonyms: | Apoptotic protease Mch-3 | CASP-7 | CASP7 | CASP7_HUMAN | CMH-1 | Caspase | MCH3 | caspase 7, apoptosis-related cysteine peptidase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34273.91 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P55210 |
|---|
| Residue: | 303 |
|---|
| Sequence: | MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ
|
|
|
|---|
| BDBM79429 |
|---|
| n/a |
|---|
| Name | BDBM79429 |
|---|
| Synonyms: | (2-oxidanylideneoxolan-3-yl) 2-(3,4-dimethoxyphenyl)quinoline-4-carboxylate | (2-oxooxolan-3-yl) 2-(3,4-dimethoxyphenyl)quinoline-4-carboxylate | 2-(3,4-dimethoxyphenyl)-4-quinolinecarboxylic acid (2-oxo-3-oxolanyl) ester | 2-(3,4-dimethoxyphenyl)cinchoninic acid (2-ketotetrahydrofuran-3-yl) ester | MLS000081723 | SMR000062971 | cid_2999765 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H19NO6 |
|---|
| Mol. Mass. | 393.3894 |
|---|
| SMILES | COc1ccc(cc1OC)-c1cc(C(=O)OC2CCOC2=O)c2ccccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
