| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-related protein A1 |
|---|
| Ligand | BDBM51883 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of UBC13 Polyubiquitin Inhibitors using a Bfl-1 counterscreen |
|---|
| IC50 | 1720±39 nM |
|---|
| Citation |  PubChem, PC Dose Response confirmation of UBC13 Polyubiquitin Inhibitors using a Bfl-1 counterscreen PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-related protein A1 |
|---|
| Name: | Bcl-2-related protein A1 |
|---|
| Synonyms: | A1 | A1-A | B-cell leukemia/lymphoma 2 related protein A1a | B2LA1_MOUSE | Bcl2a1 | Bcl2a1a | Bfl-1 | Bfl1 | Hemopoietic-specific early response protein | Protein BFL-1 |
|---|
| Type: | Apoptosis regulator protein |
|---|
| Mol. Mass.: | 19909.74 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | gi_11024684 |
|---|
| Residue: | 172 |
|---|
| Sequence: | MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFH
VESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSS
FVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK
|
|
|
|---|
| BDBM51883 |
|---|
| n/a |
|---|
| Name | BDBM51883 |
|---|
| Synonyms: | 2-(diethylamino)ethyl 4-[[(Z)-2-[4-(1,3-benzodioxol-5-yl)-1,3-thiazol-2-yl]-2-cyano-ethenyl]amino]benzoate | 2-(diethylamino)ethyl 4-[[(Z)-2-[4-(1,3-benzodioxol-5-yl)-1,3-thiazol-2-yl]-2-cyanoethenyl]amino]benzoate | 4-[(Z)-2-(4-Benzo[1,3]dioxol-5-yl-thiazol-2-yl)-2-cyano-vinylamino]-benzoic acid 2-diethylamino-ethyl ester | 4-[[(Z)-2-[4-(1,3-benzodioxol-5-yl)-2-thiazolyl]-2-cyanoethenyl]amino]benzoic acid 2-(diethylamino)ethyl ester | 4-[[(Z)-2-[4-(1,3-benzodioxol-5-yl)thiazol-2-yl]-2-cyano-vinyl]amino]benzoic acid 2-(diethylamino)ethyl ester | MLS000769346 | SMR000434080 | cid_1838764 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H26N4O4S |
|---|
| Mol. Mass. | 490.574 |
|---|
| SMILES | CCN(CC)CCOC(=O)c1ccc(cc1)N=CC(C#N)c1nc(cs1)-c1ccc2OCOc2c1 |w:16.16| |
|---|
| Structure | 
|
|---|
Search and Browse
