| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tropomyosin alpha-1 chain |
|---|
| Ligand | BDBM52242 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence-based biochemical high throughput dose response assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF) |
|---|
| EC50 | 2218±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescence-based biochemical high throughput dose response assay for activators of the calcium sensitivity of cardiac Regulated Thin Filaments (RTF) PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tropomyosin alpha-1 chain |
|---|
| Name: | Tropomyosin alpha-1 chain |
|---|
| Synonyms: | TPM1 | TPM1_PIG | cardiac alpha tropomyosin |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 32681.01 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | P42639 |
|---|
| Residue: | 284 |
|---|
| Sequence: | MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKRLEDELVSLQKKLKATEDELDKY
SEAPKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
|
|
|
|---|
| BDBM52242 |
|---|
| n/a |
|---|
| Name | BDBM52242 |
|---|
| Synonyms: | (5E)-5-[[5-(1-azepanyl)-2-furanyl]methylidene]-1-methyl-2-sulfanylidene-1,3-diazinane-4,6-dione | (5E)-5-[[5-(azepan-1-yl)-2-furyl]methylene]-1-methyl-2-thioxo-hexahydropyrimidine-4,6-quinone | (5E)-5-[[5-(azepan-1-yl)furan-2-yl]methylidene]-1-methyl-2-sulfanylidene-1,3-diazinane-4,6-dione | 5-{[5-(1-azepanyl)-2-furyl]methylene}-1-methyl-2-thioxodihydro-4,6(1H,5H)-pyrimidinedione | MLS000594435 | SMR000114505 | cid_1740011 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H19N3O3S |
|---|
| Mol. Mass. | 333.405 |
|---|
| SMILES | CN1C(=S)NC(=O)\C(=C/c2ccc(o2)N2CCCCCC2)C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
