Reaction Details |
| Report a problem with these data |
Target | DNA dC->dU-editing enzyme APOBEC-3A |
---|
Ligand | BDBM80415 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of small molecule APOBEC3A DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 1670±n/a nM |
---|
Comments | extracted |
---|
Citation | PubChem, PC Dose Response confirmation of small molecule APOBEC3A DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay PubChem Bioassay(2011)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
DNA dC->dU-editing enzyme APOBEC-3A |
---|
Name: | DNA dC->dU-editing enzyme APOBEC-3A |
Synonyms: | ABC3A_HUMAN | APOBEC3A | probable DNA dC->dU-editing enzyme APOBEC-3A |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 23013.77 |
Organism: | Homo sapiens (Human) |
Description: | gi_21955158 |
Residue: | 199 |
Sequence: | MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAK
NLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHV
RLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLD
EHSQALSGRLRAILQNQGN
|
|
|
BDBM80415 |
---|
n/a |
---|
Name | BDBM80415 |
Synonyms: | 1,3,3-Trimethyl-2-[2-(methyl-phenyl-amino)-vinyl]-3H-indolium | MLS000556742 | SMR000173748 | cid_11958735 | methyl-phenyl-[(2Z)-2-(1,3,3-trimethyl-2-indolylidene)ethylidene]ammonium;iodide | methyl-phenyl-[(2Z)-2-(1,3,3-trimethylindol-2-ylidene)ethylidene]azanium;iodide | methyl-phenyl-[(2Z)-2-(1,3,3-trimethylindolin-2-ylidene)ethylidene]ammonium;iodide |
Type | Small organic molecule |
Emp. Form. | C20H23N2 |
Mol. Mass. | 291.4095 |
SMILES | CN(\C=C\C1=[N+](C)c2ccccc2C1(C)C)c1ccccc1 |c:4| |
Structure |
|