Reaction Details |
| Report a problem with these data |
Target | Leukotriene B4 receptor 2 |
---|
Ligand | BDBM81519 |
---|
Substrate/Competitor | n/a |
---|
Ki | 66±n/a nM |
---|
Comments | PDSP_499 |
---|
Citation | Jackson, RH; Morrissey, MM; Sills, MA; Jarvis, MF Comparison of antagonist and agonist binding to the leukotriene B4 receptor intact human polymorphonuclear neutrophils (PMN). J Pharmacol Exp Ther262:80-9 (1992) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Leukotriene B4 receptor 2 |
---|
Name: | Leukotriene B4 receptor 2 |
Synonyms: | BLT2R | BLTR2 | LT4R2_HUMAN | LTB4 receptor JULF2 | LTB4-R 2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 37964.86 |
Organism: | Homo sapiens (Human) |
Description: | Leukotriene 2 0 HUMAN::Q9NPC1 |
Residue: | 358 |
Sequence: | MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
|
|
|
BDBM81519 |
---|
n/a |
---|
Name | BDBM81519 |
Synonyms: | CAS_117690-79-6 | CGS 23356 | CHEMBL15766 | LY 255283 |
Type | Small organic molecule |
Emp. Form. | C19H28N4O3 |
Mol. Mass. | 360.4506 |
SMILES | CCc1cc(C(C)=O)c(O)cc1OCCCCCC(C)(C)c1nnn[nH]1 |
Structure |
|