Reaction Details |
| Report a problem with these data |
Target | Leukotriene B4 receptor 2 |
---|
Ligand | BDBM50013889 |
---|
Substrate/Competitor | n/a |
---|
Ki | 93±n/a nM |
---|
Comments | PDSP_1103 |
---|
Citation | Jackson, RH; Morrissey, MM; Sills, MA; Jarvis, MF Comparison of antagonist and agonist binding to the leukotriene B4 receptor intact human polymorphonuclear neutrophils (PMN). J Pharmacol Exp Ther262:80-9 (1992) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Leukotriene B4 receptor 2 |
---|
Name: | Leukotriene B4 receptor 2 |
Synonyms: | BLT2R | BLTR2 | LT4R2_HUMAN | LTB4 receptor JULF2 | LTB4-R 2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 37964.86 |
Organism: | Homo sapiens (Human) |
Description: | Leukotriene 2 0 HUMAN::Q9NPC1 |
Residue: | 358 |
Sequence: | MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
|
|
|
BDBM50013889 |
---|
n/a |
---|
Name | BDBM50013889 |
Synonyms: | (5S,6Z,8E,10E,12R,14Z)-5,12-dihydroxyicosa-6,8,10,14-tetraenoic acid | (S-(R*,S*-(E,Z,E,Z)))-5,12-Dihydroxy-6,8,10,14-eicosatetraenoic acid | 5,12-Dihete | 5,12-Hete | 5S,12R-dihydroxy-6Z,8E,10E,14Z-eicosatetraenoic acid | CHEMBL65061 | DIHETE 12(s), 5(s) | LTB4 | leukotriene B4 |
Type | Small organic molecule |
Emp. Form. | C20H32O4 |
Mol. Mass. | 336.4657 |
SMILES | CCCCC\C=C/C[C@@H](O)\C=C\C=C\C=C/[C@@H](O)CCCC(O)=O |r| |
Structure |
|