Reaction Details |
| Report a problem with these data |
Target | Pituitary adenylate cyclase-activating polypeptide |
---|
Ligand | BDBM81525 |
---|
Substrate/Competitor | n/a |
---|
Ki | 10±n/a nM |
---|
Comments | PDSP_2357 |
---|
Citation | Robberecht, P; Gourlet, P; De Neef, P; Woussen-Colle, MC; Vandermeers-Piret, MC; Vandermeers, A; Christophe, J Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist. Eur J Biochem207:239-46 (1992) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Pituitary adenylate cyclase-activating polypeptide |
---|
Name: | Pituitary adenylate cyclase-activating polypeptide |
Synonyms: | ADCYAP1 | PACAP | PACA_HUMAN | Pituitary adenylate cyclase-activating polypeptide |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 18847.28 |
Organism: | Homo sapiens (Human) |
Description: | PACAP 0 HUMAN::P18509 |
Residue: | 176 |
Sequence: | MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPG
AGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGG
AGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
|
|
|
BDBM81525 |
---|
n/a |
---|
Name | BDBM81525 |
Synonyms: | [AcHis1,Phe2]PACAP(1-38) |
Type | Small molecule |
Emp. Form. | C211H337N63O53S |
Mol. Mass. | 4636.389 |
SMILES | n/a |
Structure |
|