Reaction Details |
| Report a problem with these data |
Target | Bis(5'-adenosyl)-triphosphatase |
---|
Ligand | BDBM81591 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
Ki | 2700±0.0 nM |
---|
Citation | Varnum, JM; Baraniak, J; Kaczmarek, R; Stec, WJ; Brenner, C Di-, tri- and tetra-5'-O-phosphorothioadenosyl substituted polyols as inhibitors of Fhit: Importance of the alpha-beta bridging oxygen and beta phosphorus replacement. BMC Chem Biol1:3 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bis(5'-adenosyl)-triphosphatase |
---|
Name: | Bis(5'-adenosyl)-triphosphatase |
Synonyms: | AP3A hydrolase | AP3Aase | Bis(5'adenosyl)-triphosphatase | Dinucleosidetriphosphatase | FHIT | FHIT_HUMAN | Fragile histidine triad protein |
Type: | Protein |
Mol. Mass.: | 16861.00 |
Organism: | Homo sapiens (Human) |
Description: | P49789 |
Residue: | 147 |
Sequence: | MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ
TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH
DKEDFPASWRSEEEMAAEAAALRVYFQ
|
|
|
BDBM81591 |
---|
n/a |
---|
Name | BDBM81591 |
Synonyms: | AppppA analog, 16 (X=S) |
Type | Small organic molecule |
Emp. Form. | C33H43N17O16P3S3 |
Mol. Mass. | 1122.917 |
SMILES | Nc1ncnc2n(cnc12)[C@@H]1OC(COP([O-])(=S)NCC(CNP([S-])(=O)OC[C@H]2OC([C@H](O)[C@@H]2O)n2cnc3c(N)ncnc23)OP([S-])(=O)OC[C@H]2OC([C@H](O)[C@@H]2O)n2cnc3c(N)ncnc23)[C@@H](O)[C@H]1O |r| |
Structure |
|