| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bis(5'-adenosyl)-triphosphatase |
|---|
| Ligand | BDBM81592 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| Ki | 420±0.0 nM |
|---|
| Citation |  Varnum, JM; Baraniak, J; Kaczmarek, R; Stec, WJ; Brenner, C Di-, tri- and tetra-5'-O-phosphorothioadenosyl substituted polyols as inhibitors of Fhit: Importance of the alpha-beta bridging oxygen and beta phosphorus replacement. BMC Chem Biol1:3 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bis(5'-adenosyl)-triphosphatase |
|---|
| Name: | Bis(5'-adenosyl)-triphosphatase |
|---|
| Synonyms: | AP3A hydrolase | AP3Aase | Bis(5'adenosyl)-triphosphatase | Dinucleosidetriphosphatase | FHIT | FHIT_HUMAN | Fragile histidine triad protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 16861.00 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P49789 |
|---|
| Residue: | 147 |
|---|
| Sequence: | MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ
TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH
DKEDFPASWRSEEEMAAEAAALRVYFQ
|
|
|
|---|
| BDBM81592 |
|---|
| n/a |
|---|
| Name | BDBM81592 |
|---|
| Synonyms: | AppppA analog, 17 (X=O) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H29N10O18P3 |
|---|
| Mol. Mass. | 826.456 |
|---|
| SMILES | Nc1ncnc2n(cnc12)C1O[C@H](COP([O-])(=O)OCC(COP([O-])(=O)OCC2O[C@H]([C@H](O)[C@@H]2O)n2cnc3c(N)ncnc23)OP([O-])([O-])=O)[C@@H](O)[C@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
