Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCHRM5
LigandBDBM81768
Substrate/Competitorn/a
Ki 0.043±n/a nM
CommentsPDSP_2042
Citation Bolden CCusack BRichelson E Antagonism by antimuscarinic and neuroleptic compounds at the five cloned human muscarinic cholinergic receptors expressed in Chinese hamster ovary cells. J Pharmacol Exp Ther 260:576-80 (1992) [PubMed]
More Info.:Get all data from this article
 
CHRM5
Name:Muscarinic acetylcholine receptor M1/M5 chimeric protein
Synonyms:Muscarinic acetylcholine receptor | Muscarinic acetylcholine receptor M5 | muscarinic acetylcholine receptor M5
Type:PROTEIN
Mol. Mass.:60102.35
Organism:Homo sapiens (Human)
Description:ChEMBL_1517990
Residue:532
Sequence:
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81768
n/a
NameBDBM81768
Synonyms:BENZYLIC ACID | CAS_6581-06-2 | NSC_5311391 | Quinuclidinyl benzilate
TypeSmall organic molecule
Emp. Form.C14H12O3
Mol. Mass.228.2433
SMILESOC(=O)C(O)(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: