Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR1D
LigandBDBM50014406
Substrate/Competitorn/a
Ki 398±n/a nM
CommentsPDSP_154
Citation Weinshank RLZgombick JMMacchi MJBranchek TAHartig PR Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc Natl Acad Sci U S A 89:3630-4 (1992) [PubMed]
More Info.:Get all data from this article
 
HTR1D
Name:5-hydroxytryptamine 1D receptor (5HT1D)
Synonyms:n/a
Type:Protein
Mol. Mass.:12731.52
Organism:Bos taurus (Bovine)
Description:Q8MI13
Residue:119
Sequence:
SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014406
n/a
NameBDBM50014406
Synonyms:2-Me 5-HT | 2-Methyl-5-hydroxytryptamine | 2-methyl-5-HT | 2-methylserotonin | 3-(2-aminoethyl)-2-methyl-1H-indol-5-ol | 5-HT,2-Me | CHEMBL266591
TypeSmall organic molecule
Emp. Form.C11H14N2O
Mol. Mass.190.2417
SMILESCc1[nH]c2ccc(O)cc2c1CCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: