Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine 1D receptor |
---|
Ligand | BDBM10755 |
---|
Substrate/Competitor | n/a |
---|
Ki | 4±n/a nM |
---|
Comments | PDSP_150 |
---|
Citation | Weinshank, RL; Zgombick, JM; Macchi, MJ; Branchek, TA; Hartig, PR Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc Natl Acad Sci U S A89:3630-4 (1992) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
5-hydroxytryptamine 1D receptor |
---|
Name: | 5-hydroxytryptamine 1D receptor |
Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
Type: | Protein |
Mol. Mass.: | 12731.52 |
Organism: | Bos taurus (Bovine) |
Description: | Q8MI13 |
Residue: | 119 |
Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
BDBM10755 |
---|
n/a |
---|
Name | BDBM10755 |
Synonyms: | 14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT |
Type | Small organic molecule |
Emp. Form. | C10H12N2O |
Mol. Mass. | 176.2151 |
SMILES | NCCc1c[nH]c2ccc(O)cc12 |
Structure |
|