Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine 1D receptor |
---|
Ligand | BDBM21393 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1260±n/a nM |
---|
Comments | PDSP_738 |
---|
Citation | Weinshank, RL; Zgombick, JM; Macchi, MJ; Branchek, TA; Hartig, PR Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc Natl Acad Sci U S A89:3630-4 (1992) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
5-hydroxytryptamine 1D receptor |
---|
Name: | 5-hydroxytryptamine 1D receptor |
Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
Type: | Protein |
Mol. Mass.: | 12731.52 |
Organism: | Bos taurus (Bovine) |
Description: | Q8MI13 |
Residue: | 119 |
Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
BDBM21393 |
---|
n/a |
---|
Name | BDBM21393 |
Synonyms: | 7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-1-ol | 8-Hydroxy-2-(di-n-propylamino)tetralin | 8-OH-DPAT | 8-OH-DPAT,(+) | 8-OH-DPAT,(-) | 8-hydroxy-N,N-dipropylaminotetralin | CHEMBL1788118 | CHEMBL505765 | CHEMBL56 | DPAT | US10562853, Compound 8-OH-DPAT | [3H]-8-OH-DPAT | cid_1220 |
Type | radiolabeled ligand |
Emp. Form. | C16H25NO |
Mol. Mass. | 247.3758 |
SMILES | CCCN(CCC)C1CCc2cccc(O)c2C1 |
Structure |
|