Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine 1D receptor |
---|
Ligand | BDBM50013515 |
---|
Substrate/Competitor | n/a |
---|
Ki | 20±n/a nM |
---|
Comments | PDSP_1590 |
---|
Citation | Weinshank, RL; Zgombick, JM; Macchi, MJ; Branchek, TA; Hartig, PR Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc Natl Acad Sci U S A89:3630-4 (1992) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
5-hydroxytryptamine 1D receptor |
---|
Name: | 5-hydroxytryptamine 1D receptor |
Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
Type: | Protein |
Mol. Mass.: | 12731.52 |
Organism: | Bos taurus (Bovine) |
Description: | Q8MI13 |
Residue: | 119 |
Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
BDBM50013515 |
---|
n/a |
---|
Name | BDBM50013515 |
Synonyms: | (+)-yohimbine | (16alpha,17alpha)-17-hydroxyyohimban-16-carboxylic acid methyl ester | 17alpha-hydroxyyohimban-16alpha-carboxylic acid methyl ester | CHEMBL15245 | CORYNANTHINE | Johimbin | Quebrachin | RAUWOLSCINE | YOHIMBINE CHLORIDE | Yohimbin | Yohimbine | aphrodine | cid_8969 | corynine | methyl 17alpha-hydroxyyohimban-16alpha-carboxylate | quebrachine | yohimbic acid methyl ester |
Type | Small organic molecule |
Emp. Form. | C21H26N2O3 |
Mol. Mass. | 354.4427 |
SMILES | COC(=O)[C@H]1[C@@H](O)CC[C@H]2CN3CCc4c([nH]c5ccccc45)[C@@H]3C[C@H]12 |r| |
Structure |
|