| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine 1D receptor |
|---|
| Ligand | BDBM50056401 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 2511.88±n/a nM |
|---|
| Comments | PDSP_1689 |
|---|
| Citation |  Buchheit, KH; Gamse, R; Pfannkuche, HJ SDZ 205-557, a selective, surmountable antagonist for 5-HT4 receptors in the isolated guinea pig ileum. Naunyn Schmiedebergs Arch Pharmacol345:387-93 (1992) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine 1D receptor |
|---|
| Name: | 5-hydroxytryptamine 1D receptor |
|---|
| Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12731.52 |
|---|
| Organism: | Bos taurus (Bovine) |
|---|
| Description: | Q8MI13 |
|---|
| Residue: | 119 |
|---|
| Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
|---|
| BDBM50056401 |
|---|
| n/a |
|---|
| Name | BDBM50056401 |
|---|
| Synonyms: | 2-diethylaminoethyl [2-methoxy-4-amino-5-chloro]benzoate | 4-Amino-5-chloro-2-methoxy-benzoic acid 2-diethylamino-ethyl ester | CHEMBL287045 | SDZ 205557 | SDZ-205557 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H21ClN2O3 |
|---|
| Mol. Mass. | 300.781 |
|---|
| SMILES | CCN(CC)CCOC(=O)c1cc(Cl)c(N)cc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
