| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protachykinin-1 |
|---|
| Ligand | BDBM81818 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_2651 |
|---|
| Citation |  Garritsen, A; Ijzerman, AP; Tulp, MT; Cragoe, EJ; Soudijn, W Receptor binding profiles of amiloride analogues provide no evidence for a link between receptors and the Na+/H+ exchanger, but indicate a common structure on receptor proteins. J Recept Res11:891-907 (1991) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Protachykinin-1 |
|---|
| Name: | Protachykinin-1 |
|---|
| Synonyms: | Nka | Nkna | Protachykinin-1 | Substance K | Substance P | TKN1_RAT | Tac1 | Tac2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 15007.06 |
|---|
| Organism: | RAT |
|---|
| Description: | Substance K 0 RAT::P06767 |
|---|
| Residue: | 130 |
|---|
| Sequence: | MKILVAVAVFFLVSTQLFAEEIGANDDLNYWSDWSDSDQIKEAMPEPFEHLLQRIARRPK
PQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
AMQNYERRRK
|
|
|
|---|
| BDBM81818 |
|---|
| n/a |
|---|
| Name | BDBM81818 |
|---|
| Synonyms: | CAS_1794 | CHEMBL1909810 | HMA | NSC_1794 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H18ClN7O |
|---|
| Mol. Mass. | 311.771 |
|---|
| SMILES | NC(=N)NC(=O)c1nc(Cl)c(nc1N)N1CCCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
