Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor
LigandBDBM50026957
Substrate/Competitorn/a
Ki 0.48±n/a nM
CommentsPDSP_268
Citation Neve KA Regulation of dopamine D2 receptors by sodium and pH. Mol Pharmacol 39:570-8 (1991) [PubMed]
More Info.:Get all data from this article
 
Dopamine D2 receptor
Name:Dopamine receptor
Synonyms:D(2) dopamine receptor | DOPAMINE D2 | DRD2 | Dopamine Receptor D2 | Dopamine receptor | Dopamine2-like
Type:Enzyme
Mol. Mass.:50957.64
Organism:Mus musculus (Mouse)
Description:P61168
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKPDRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026957
n/a
NameBDBM50026957
Synonyms:(cis) 2-{4-[3-(2-Trifluoromethyl-thioxanthen-9-ylidene)-propyl]-piperazin-1-yl}-ethanol(Flupentixol) | (trans-flupenthixol)2-{4-[3-(2-Trifluoromethyl-thioxanthen-9-ylidene)-propyl]-piperazin-1-yl}-ethanol | 2-(4-{3-[2-Trifluoromethyl-thioxanthen-(9E)-ylidene]-propyl}-piperazin-1-yl)-ethanol | 2-{4-[3-(2-Trifluoromethyl-thioxanthen-9-ylidene)-propyl]-piperazin-1-yl}-ethanol | FLUPENTHIXOL, Alpha | FLUPENTHIXOL2-{4-[3-(2-Trifluoromethyl-thioxanthen-9-ylidene)-propyl]-piperazin-1-yl}-ethanol | Flupenthixol | Flupenthixol, Beta
TypeSmall organic molecule
Emp. Form.C23H25F3N2OS
Mol. Mass.434.518
SMILESOCCN1CCN(CC\C=C2/c3ccccc3Sc3ccc(cc23)C(F)(F)F)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: