| Reaction Details |
|---|
 | Report a problem with these data |
| Target | ATP synthase subunit a |
|---|
| Ligand | BDBM50281563 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 23±n/a nM |
|---|
| Comments | PDSP_1488 |
|---|
| Citation |  Burcher, E; Buck, SH; Lovenberg, W; O'Donohue, TL Characterization and autoradiographic localization of multiple tachykinin binding sites in gastrointestinal tract and bladder. J Pharmacol Exp Ther236:819-31 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| ATP synthase subunit a |
|---|
| Name: | ATP synthase subunit a |
|---|
| Synonyms: | ATP synthase subunit a | ATP6_RAT | Atp6 | Atpase6 | BHE | Mt-atp6 | Mtatp6 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25083.82 |
|---|
| Organism: | RAT |
|---|
| Description: | P05504 |
|---|
| Residue: | 226 |
|---|
| Sequence: | MNENLFASFITPTMMGLPIVVTIIMFPSILFPSSERLISNRLHSFQHWLIKLIIKQMMLI
HTPKGRTWALMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMNLSMAIPLWAGAVILGFRHK
LKNSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLV
LMDISPPTATITFIILLLLTVLEFAVALIQAYVFTLLVSLYLHDNT
|
|
|
|---|
| BDBM50281563 |
|---|
| n/a |
|---|
| Name | BDBM50281563 |
|---|
| Synonyms: | CHEMBL414786 | pGlu-Ala-Asp-Pro-Asn-Lys-Phe-Tyr-Gly-Leu-Met-NH2 | physalaemin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C58H84N14O16S |
|---|
| Mol. Mass. | 1265.437 |
|---|
| SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)C1CCC(=O)N1)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
