Reaction Details |
| Report a problem with these data |
Target | ATP synthase subunit a |
---|
Ligand | BDBM81942 |
---|
Substrate/Competitor | n/a |
---|
Ki | 36±n/a nM |
---|
Comments | PDSP_1774 |
---|
Citation | Burcher, E; Buck, SH; Lovenberg, W; O'Donohue, TL Characterization and autoradiographic localization of multiple tachykinin binding sites in gastrointestinal tract and bladder. J Pharmacol Exp Ther236:819-31 (1986) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
ATP synthase subunit a |
---|
Name: | ATP synthase subunit a |
Synonyms: | ATP synthase subunit a | ATP6_RAT | Atp6 | Atpase6 | BHE | Mt-atp6 | Mtatp6 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25083.82 |
Organism: | RAT |
Description: | P05504 |
Residue: | 226 |
Sequence: | MNENLFASFITPTMMGLPIVVTIIMFPSILFPSSERLISNRLHSFQHWLIKLIIKQMMLI
HTPKGRTWALMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMNLSMAIPLWAGAVILGFRHK
LKNSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLV
LMDISPPTATITFIILLLLTVLEFAVALIQAYVFTLLVSLYLHDNT
|
|
|
BDBM81942 |
---|
n/a |
---|
Name | BDBM81942 |
Synonyms: | CAS_55582 | NKA | NSC_55582 | Neurokinin alpha | Substance K |
Type | Small organic molecule |
Emp. Form. | C50H80N14O14S |
Mol. Mass. | 1133.321 |
SMILES | CSCCC(NC(=O)C(CC(C)C)NC(=O)CNC(=O)C(NC(=O)C(Cc1ccccc1)NC(=O)C(CO)NC(=O)C(CC(O)=O)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C(N)Cc1cnc[nH]1)C(C)O)C(C)C)C(N)=O |
Structure |
|