| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protachykinin-1 |
|---|
| Ligand | BDBM81944 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 20±n/a nM |
|---|
| Comments | PDSP_1306 |
|---|
| Citation |  Burcher, E; Buck, SH; Lovenberg, W; O'Donohue, TL Characterization and autoradiographic localization of multiple tachykinin binding sites in gastrointestinal tract and bladder. J Pharmacol Exp Ther236:819-31 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Protachykinin-1 |
|---|
| Name: | Protachykinin-1 |
|---|
| Synonyms: | Nka | Nkna | Protachykinin-1 | Substance K | Substance P | TKN1_MOUSE | Tac1 | Tac2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 15050.06 |
|---|
| Organism: | MOUSE |
|---|
| Description: | Substance K 0 MOUSE::P41539 |
|---|
| Residue: | 130 |
|---|
| Sequence: | MKILVAVAVFFLVSTQLFAEEIDANDDLNYWSDWSDSDQIKEAMPEPFEHLLQRIARRPK
PQQFFGLMGKRDADSSVEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
AMQNYERRRK
|
|
|
|---|
| BDBM81944 |
|---|
| n/a |
|---|
| Name | BDBM81944 |
|---|
| Synonyms: | CAS_86933-75-7 | NKB | NSC_5311312 | neuromedin K |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C55H79N13O14S2 |
|---|
| Mol. Mass. | 1210.424 |
|---|
| SMILES | CSCCC(NC(=O)C(CC(C)C)NC(=O)CNC(=O)C(NC(=O)C(Cc1ccccc1)NC(=O)C(Cc1ccccc1)NC(=O)C(CC(O)=O)NC(=O)C(Cc1cnc[nH]1)NC(=O)C(CCSC)NC(=O)C(N)CC(O)=O)C(C)C)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
