Reaction Details |
| Report a problem with these data |
Target | Protachykinin-1 |
---|
Ligand | BDBM50194558 |
---|
Substrate/Competitor | n/a |
---|
Ki | 5±n/a nM |
---|
Comments | PDSP_778 |
---|
Citation | Burcher, E; Buck, SH; Lovenberg, W; O'Donohue, TL Characterization and autoradiographic localization of multiple tachykinin binding sites in gastrointestinal tract and bladder. J Pharmacol Exp Ther236:819-31 (1986) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Protachykinin-1 |
---|
Name: | Protachykinin-1 |
Synonyms: | Nka | Nkna | Protachykinin-1 | Substance K | Substance P | TKN1_MOUSE | Tac1 | Tac2 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 15050.06 |
Organism: | MOUSE |
Description: | Substance K 0 MOUSE::P41539 |
Residue: | 130 |
Sequence: | MKILVAVAVFFLVSTQLFAEEIDANDDLNYWSDWSDSDQIKEAMPEPFEHLLQRIARRPK
PQQFFGLMGKRDADSSVEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
AMQNYERRRK
|
|
|
BDBM50194558 |
---|
n/a |
---|
Name | BDBM50194558 |
Synonyms: | CHEMBL373569 | ELEDOISIN |
Type | Small organic molecule |
Emp. Form. | C54H85N13O15S |
Mol. Mass. | 1188.396 |
SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCC(=O)N1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(N)=O |
Structure |
|