| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 2B |
|---|
| Ligand | BDBM21397 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.8±n/a nM |
|---|
| Comments | PDSP_1739 |
|---|
| Citation |  McKenna, DJ; Peroutka, SJ Differentiation of 5-hydroxytryptamine2 receptor subtypes using 125I-R-(-)2,5-dimethoxy-4-iodo-phenylisopropylamine and 3H-ketanserin. J Neurosci9:3482-90 (1989) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine receptor 2B |
|---|
| Name: | 5-hydroxytryptamine receptor 2B |
|---|
| Synonyms: | 5-HT2B | 5-hydroxytryptamine 2B receptor | HTR2B |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 15564.62 |
|---|
| Organism: | BOVINE |
|---|
| Description: | Q8MI09 |
|---|
| Residue: | 137 |
|---|
| Sequence: | KPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGFHKDKTLPNASADILMRRMSTVGKKSV
QTISNEQRASKVLGIVFFLFLLMWCPFFITNVTLVLCDSCNQTTLNMLLEIFVWIGYVSS
GVNPLVYTLFNKTFRDA
|
|
|
|---|
| BDBM21397 |
|---|
| n/a |
|---|
| Name | BDBM21397 |
|---|
| Synonyms: | 8-[4-(4-fluorophenyl)-4-keto-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxidanylidene-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxobutyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | CHEMBL267930 | MLS000028615 | SMR000058674 | SPIPERONE | Spiroperidol | US9359372, Spiperone | [3H]-Spiroperidol | cid_5265 |
|---|
| Type | radiolabeled ligand |
|---|
| Emp. Form. | C23H26FN3O2 |
|---|
| Mol. Mass. | 395.4698 |
|---|
| SMILES | Fc1ccc(cc1)C(=O)CCCN1CCC2(CC1)N(CNC2=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
