Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 2B |
---|
Ligand | BDBM21397 |
---|
Substrate/Competitor | n/a |
---|
Ki | 0.8±n/a nM |
---|
Comments | PDSP_1739 |
---|
Citation | McKenna, DJ; Peroutka, SJ Differentiation of 5-hydroxytryptamine2 receptor subtypes using 125I-R-(-)2,5-dimethoxy-4-iodo-phenylisopropylamine and 3H-ketanserin. J Neurosci9:3482-90 (1989) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
5-hydroxytryptamine receptor 2B |
---|
Name: | 5-hydroxytryptamine receptor 2B |
Synonyms: | 5-HT2B | 5-hydroxytryptamine 2B receptor | HTR2B |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 15564.62 |
Organism: | BOVINE |
Description: | Q8MI09 |
Residue: | 137 |
Sequence: | KPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGFHKDKTLPNASADILMRRMSTVGKKSV
QTISNEQRASKVLGIVFFLFLLMWCPFFITNVTLVLCDSCNQTTLNMLLEIFVWIGYVSS
GVNPLVYTLFNKTFRDA
|
|
|
BDBM21397 |
---|
n/a |
---|
Name | BDBM21397 |
Synonyms: | 8-[4-(4-fluorophenyl)-4-keto-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxidanylidene-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxobutyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | CHEMBL267930 | MLS000028615 | SMR000058674 | SPIPERONE | Spiroperidol | US9359372, Spiperone | [3H]-Spiroperidol | cid_5265 |
Type | radiolabeled ligand |
Emp. Form. | C23H26FN3O2 |
Mol. Mass. | 395.4698 |
SMILES | Fc1ccc(cc1)C(=O)CCCN1CCC2(CC1)N(CNC2=O)c1ccccc1 |
Structure |
|