Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHRH3
LigandBDBM22904
Substrate/Competitorn/a
Ki 1060±n/a nM
CommentsPDSP_270
Citation Arrang JMGarbarg MLancelot JCLecomte JMPollard HRobba MSchunack WSchwartz JC Highly potent and selective ligands for a new class H3 of histamine receptor. Invest Radiol 0:0-2 (1988) [PubMed]  Article
More Info.:Get all data from this article
 
HRH3
Name:HRH3
Synonyms:HISTAMINE H3 | Hrh3 protein
Type:Enzyme Catalytic Domain
Mol. Mass.:37860.96
Organism:RAT
Description:Q5PPG3
Residue:344
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRGSKPSASSASLEKRMKMVSQSITQRF
RLSRDKKVAKSLAIIVSIFGLCWAPYTLLMIIRAACHGRCIPDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22904
n/a
NameBDBM22904
Synonyms:(2R)-1-(1H-imidazol-5-yl)propan-2-amine | (R)-alpha-Methylhistamine | Alpha-Methylhistamine-R | Alpha-Methylhistane-R | CHEMBL268229 | R-alpha-methylhistamine | RAMH
TypeSmall organic molecule
Emp. Form.C6H11N3
Mol. Mass.125.1716
SMILESC[C@@H](N)Cc1cnc[nH]1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: