Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM81982 |
---|
Substrate/Competitor | n/a |
---|
Ki | 28±n/a nM |
---|
Comments | PDSP_3945 |
---|
Citation | Korstanje, C; Sprenkels, R; Doods, HN; Hugtenburg, JG; Boddeke, E; Batink, HD; Thoolen, MJ; Van Zwieten, PA Characterization of flufylline, fluprofylline, ritanserin, butanserin and R 56413 with respect to in-vivo alpha 1-,alpha 2- and 5-HT2-receptor antagonism and in-vitro affinity for alpha 1-,alpha 2- and 5-HT2-receptors: comparison with ketanserin. J Pharm Pharmacol38:374-9 (1986) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM81982 |
---|
n/a |
---|
Name | BDBM81982 |
Synonyms: | CAS_97-39-2 | DITOLYLGUANIDINE | DTG | Di-o-tolylguanidine | Tol2Gdn | cid_7333 |
Type | Small organic molecule |
Emp. Form. | C15H17N3 |
Mol. Mass. | 239.3156 |
SMILES | Cc1ccccc1NC(N)=Nc1ccccc1C |w:10.11| |
Structure |
|